PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca15219.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family TALE
Protein Properties Length: 165aa    MW: 19406.6 Da    PI: 6.6379
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca15219.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.4e-10911262055
                 HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Dca15219.1  91 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 126
                 5679*****************************985 PP

2ELK37.55e-134667122
         ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                ELK+qLl+KYsgyL+sLkqE+s
  Dca15219.1 46 ELKNQLLKKYSGYLSSLKQELS 67
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037892.5E-104667IPR005539ELK domain
PROSITE profilePS5121311.2614666IPR005539ELK domain
SMARTSM011887.9E-74667IPR005539ELK domain
PROSITE profilePS5007112.84366129IPR001356Homeobox domain
SuperFamilySSF466894.28E-2067143IPR009057Homeodomain-like
SMARTSM003895.2E-1368133IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.4E-2771132IPR009057Homeodomain-like
CDDcd000861.90E-1275130No hitNo description
PfamPF059203.0E-1786125IPR008422Homeobox KN domain
PROSITE patternPS000270104127IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MYHTRESPDN YIHDKTEGVG SSEEDQENSG GDNEVPEFDP RAEDRELKNQ LLKKYSGYLS  60
SLKQELSKKK KKGKLPNDAR QKLLTWWELH YKWPYPSESE KVALAESTGL DQKQINNWFI  120
NQRKRHWKPS EDMQFMVMDG MHPHNAPPFF MDGHYIGDAP YRFGT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001305604.17e-88homeotic protein knotted-1
RefseqXP_010692662.14e-87PREDICTED: homeotic protein knotted-1
SwissprotO041354e-87KNAP2_MALDO; Homeobox protein knotted-1-like 2
SwissprotQ413302e-87KN1_SOLLC; Homeotic protein knotted-1
TrEMBLA0A0G3FKK08e-88A0A0G3FKK0_SOLTU; Knox variant X2
TrEMBLA0A0J8BE844e-87A0A0J8BE84_BETVU; Uncharacterized protein
TrEMBLA0A0K9QPR34e-89A0A0K9QPR3_SPIOL; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000127125e-86(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-67KNOTTED-like from Arabidopsis thaliana